CLPX polyclonal antibody
  • CLPX polyclonal antibody

CLPX polyclonal antibody

Ref: AB-PAB23645
CLPX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLPX.
Información adicional
Size 100 uL
Gene Name CLPX
Gene Alias -
Gene Description ClpX caseinolytic peptidase X homolog (E. coli)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLPX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10845
Iso type IgG

Enviar uma mensagem


CLPX polyclonal antibody

CLPX polyclonal antibody