OVCH1 polyclonal antibody
  • OVCH1 polyclonal antibody

OVCH1 polyclonal antibody

Ref: AB-PAB23643
OVCH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OVCH1.
Información adicional
Size 100 uL
Gene Name OVCH1
Gene Alias OVCH
Gene Description ovochymase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NCIYDAVVIYGDSEEKHKLAKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDVCGIPPFSPQWL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OVCH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341350
Iso type IgG

Enviar uma mensagem


OVCH1 polyclonal antibody

OVCH1 polyclonal antibody