STAMBPL1 polyclonal antibody
  • STAMBPL1 polyclonal antibody

STAMBPL1 polyclonal antibody

Ref: AB-PAB23635
STAMBPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STAMBPL1.
Información adicional
Size 100 uL
Gene Name STAMBPL1
Gene Alias ALMalpha|AMSH-FP|AMSH-LP|FLJ31524|KIAA1373|bA399O19.2
Gene Description STAM binding protein-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STAMBPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57559
Iso type IgG

Enviar uma mensagem


STAMBPL1 polyclonal antibody

STAMBPL1 polyclonal antibody