SEC24C polyclonal antibody
  • SEC24C polyclonal antibody

SEC24C polyclonal antibody

Ref: AB-PAB23633
SEC24C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC24C.
Información adicional
Size 100 uL
Gene Name SEC24C
Gene Alias KIAA0079
Gene Description SEC24 family, member C (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPYPAAPTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC24C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9632
Iso type IgG

Enviar uma mensagem


SEC24C polyclonal antibody

SEC24C polyclonal antibody