TMEM181 polyclonal antibody
  • TMEM181 polyclonal antibody

TMEM181 polyclonal antibody

Ref: AB-PAB23630
TMEM181 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM181.
Información adicional
Size 100 uL
Gene Name TMEM181
Gene Alias GPR178|KIAA1423
Gene Description transmembrane protein 181
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KNALYESQLKDNPAFSMLNDSDDDVIYGSDYEEMPLQNGQAIRAKYKEESDSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM181.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57583
Iso type IgG

Enviar uma mensagem


TMEM181 polyclonal antibody

TMEM181 polyclonal antibody