SPATA13 polyclonal antibody
  • SPATA13 polyclonal antibody

SPATA13 polyclonal antibody

Ref: AB-PAB23629
SPATA13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA13.
Información adicional
Size 100 uL
Gene Name SPATA13
Gene Alias ASEF2|FLJ31208|FLJ35435|MGC129988|MGC129989
Gene Description spermatogenesis associated 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221178
Iso type IgG

Enviar uma mensagem


SPATA13 polyclonal antibody

SPATA13 polyclonal antibody