CHCHD8 polyclonal antibody
  • CHCHD8 polyclonal antibody

CHCHD8 polyclonal antibody

Ref: AB-PAB23625
CHCHD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD8.
Información adicional
Size 100 uL
Gene Name CHCHD8
Gene Alias DKFZp762H1711|E2IG2|MGC117206
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51287
Iso type IgG

Enviar uma mensagem


CHCHD8 polyclonal antibody

CHCHD8 polyclonal antibody