MYO16 polyclonal antibody
  • MYO16 polyclonal antibody

MYO16 polyclonal antibody

Ref: AB-PAB23623
MYO16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO16.
Información adicional
Size 100 uL
Gene Name MYO16
Gene Alias KIAA0865|MYR8|Myo16b
Gene Description myosin XVI
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGVTMETAYSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23026
Iso type IgG

Enviar uma mensagem


MYO16 polyclonal antibody

MYO16 polyclonal antibody