PRIM1 polyclonal antibody
  • PRIM1 polyclonal antibody

PRIM1 polyclonal antibody

Ref: AB-PAB23609
PRIM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRIM1.
Información adicional
Size 100 uL
Gene Name PRIM1
Gene Alias MGC12308|p49
Gene Description primase, DNA, polypeptide 1 (49kDa)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRIM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5557
Iso type IgG

Enviar uma mensagem


PRIM1 polyclonal antibody

PRIM1 polyclonal antibody