UFSP2 polyclonal antibody
  • UFSP2 polyclonal antibody

UFSP2 polyclonal antibody

Ref: AB-PAB23608
UFSP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UFSP2.
Información adicional
Size 100 uL
Gene Name UFSP2
Gene Alias C4orf20|FLJ11200
Gene Description UFM1-specific peptidase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MLEMSTSLAAVTPIIERESGGHHYVNMTLPVDAVISVAPEETWGKVRKLLVDAIHNQLTDMEKCILKYMKGTSIVVPEPLHF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UFSP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55325
Iso type IgG

Enviar uma mensagem


UFSP2 polyclonal antibody

UFSP2 polyclonal antibody