AP4S1 polyclonal antibody
  • AP4S1 polyclonal antibody

AP4S1 polyclonal antibody

Ref: AB-PAB23605
AP4S1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AP4S1.
Información adicional
Size 100 uL
Gene Name AP4S1
Gene Alias AP47B|CLA20|CLAPS4|FLJ32366
Gene Description adaptor-related protein complex 4, sigma 1 subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP4S1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11154
Iso type IgG

Enviar uma mensagem


AP4S1 polyclonal antibody

AP4S1 polyclonal antibody