PAAF1 polyclonal antibody
  • PAAF1 polyclonal antibody

PAAF1 polyclonal antibody

Ref: AB-PAB23604
PAAF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PAAF1.
Información adicional
Size 100 uL
Gene Name PAAF1
Gene Alias FLJ11848|PAAF|Rpn14|WDR71
Gene Description proteasomal ATPase-associated factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PAAF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80227
Iso type IgG

Enviar uma mensagem


PAAF1 polyclonal antibody

PAAF1 polyclonal antibody