ANKRD13D polyclonal antibody
  • ANKRD13D polyclonal antibody

ANKRD13D polyclonal antibody

Ref: AB-PAB23603
ANKRD13D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD13D.
Información adicional
Size 100 uL
Gene Name ANKRD13D
Gene Alias MGC50828
Gene Description ankyrin repeat domain 13 family, member D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITFSNLCGCDEPLSSVWVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD13D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338692
Iso type IgG

Enviar uma mensagem


ANKRD13D polyclonal antibody

ANKRD13D polyclonal antibody