TMEM72 polyclonal antibody
  • TMEM72 polyclonal antibody

TMEM72 polyclonal antibody

Ref: AB-PAB23595
TMEM72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM72.
Información adicional
Size 100 uL
Gene Name TMEM72
Gene Alias C10orf127|DKFZp686M0585|KSP37|MGC157906|bA285G1.3
Gene Description transmembrane protein 72
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM72.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 643236
Iso type IgG

Enviar uma mensagem


TMEM72 polyclonal antibody

TMEM72 polyclonal antibody