ZDHHC16 polyclonal antibody
  • ZDHHC16 polyclonal antibody

ZDHHC16 polyclonal antibody

Ref: AB-PAB23594
ZDHHC16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZDHHC16.
Información adicional
Size 100 uL
Gene Name ZDHHC16
Gene Alias APH2|MGC2993
Gene Description zinc finger, DHHC-type containing 16
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZDHHC16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84287
Iso type IgG

Enviar uma mensagem


ZDHHC16 polyclonal antibody

ZDHHC16 polyclonal antibody