NEDD4 polyclonal antibody
  • NEDD4 polyclonal antibody

NEDD4 polyclonal antibody

Ref: AB-PAB23591
NEDD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEDD4.
Información adicional
Size 100 uL
Gene Name NEDD4
Gene Alias KIAA0093|MGC176705|NEDD4-1|RPF1
Gene Description neural precursor cell expressed, developmentally down-regulated 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEDD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4734
Iso type IgG

Enviar uma mensagem


NEDD4 polyclonal antibody

NEDD4 polyclonal antibody