BCO2 polyclonal antibody
  • BCO2 polyclonal antibody

BCO2 polyclonal antibody

Ref: AB-PAB23586
BCO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCO2.
Información adicional
Size 100 uL
Gene Name BCO2
Gene Alias B-DIOX-II|BCDO2|FLJ34464
Gene Description beta-carotene oxygenase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83875
Iso type IgG

Enviar uma mensagem


BCO2 polyclonal antibody

BCO2 polyclonal antibody