THAP2 polyclonal antibody
  • THAP2 polyclonal antibody

THAP2 polyclonal antibody

Ref: AB-PAB23580
THAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THAP2.
Información adicional
Size 100 uL
Gene Name THAP2
Gene Alias DKFZp564I0422
Gene Description THAP domain containing, apoptosis associated protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83591
Iso type IgG

Enviar uma mensagem


THAP2 polyclonal antibody

THAP2 polyclonal antibody