MFSD5 polyclonal antibody
  • MFSD5 polyclonal antibody

MFSD5 polyclonal antibody

Ref: AB-PAB23579
MFSD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFSD5.
Información adicional
Size 100 uL
Gene Name MFSD5
Gene Alias MGC11308
Gene Description major facilitator superfamily domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KVIPETEQAGVLNWFRVPLHSLACLGLLVLHDSDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFSD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84975
Iso type IgG

Enviar uma mensagem


MFSD5 polyclonal antibody

MFSD5 polyclonal antibody