KIAA1468 polyclonal antibody
  • KIAA1468 polyclonal antibody

KIAA1468 polyclonal antibody

Ref: AB-PAB23572
KIAA1468 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1468.
Información adicional
Size 100 uL
Gene Name KIAA1468
Gene Alias FLJ33841|HsT3308|HsT885
Gene Description KIAA1468
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHKYPERRLLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1468.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57614
Iso type IgG

Enviar uma mensagem


KIAA1468 polyclonal antibody

KIAA1468 polyclonal antibody