DNHD1 polyclonal antibody
  • DNHD1 polyclonal antibody

DNHD1 polyclonal antibody

Ref: AB-PAB23571
DNHD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNHD1.
Información adicional
Size 100 uL
Gene Name DNHD1
Gene Alias DHCD1|FLJ32752|FLJ46184
Gene Description dynein heavy chain domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNHD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144132
Iso type IgG

Enviar uma mensagem


DNHD1 polyclonal antibody

DNHD1 polyclonal antibody