CASC1 polyclonal antibody
  • CASC1 polyclonal antibody

CASC1 polyclonal antibody

Ref: AB-PAB23567
CASC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CASC1.
Información adicional
Size 100 uL
Gene Name CASC1
Gene Alias FLJ10921|LAS1
Gene Description cancer susceptibility candidate 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESEAIKCEREMKVLSETVSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55259
Iso type IgG

Enviar uma mensagem


CASC1 polyclonal antibody

CASC1 polyclonal antibody