FAM107B polyclonal antibody
  • FAM107B polyclonal antibody

FAM107B polyclonal antibody

Ref: AB-PAB23566
FAM107B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM107B.
Información adicional
Size 100 uL
Gene Name FAM107B
Gene Alias C10orf45|FLJ45505|MGC11034|MGC90261
Gene Description family with sequence similarity 107, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FHASIPRPSIIDTPKEEEFREEPKCLELEQKMTSDSPPEDIDHKDSYLITRSIMAEPDYIEDDNPELIRPQKLINPVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM107B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83641
Iso type IgG

Enviar uma mensagem


FAM107B polyclonal antibody

FAM107B polyclonal antibody