LSM11 polyclonal antibody
  • LSM11 polyclonal antibody

LSM11 polyclonal antibody

Ref: AB-PAB23564
LSM11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LSM11.
Información adicional
Size 100 uL
Gene Name LSM11
Gene Alias FLJ38273
Gene Description LSM11, U7 small nuclear RNA associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RSVPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LSM11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 134353
Iso type IgG

Enviar uma mensagem


LSM11 polyclonal antibody

LSM11 polyclonal antibody