GMCL1 polyclonal antibody
  • GMCL1 polyclonal antibody

GMCL1 polyclonal antibody

Ref: AB-PAB23562
GMCL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GMCL1.
Información adicional
Size 100 uL
Gene Name GMCL1
Gene Alias BTBD13|GCL|GCL1
Gene Description germ cell-less homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GMCL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64395
Iso type IgG

Enviar uma mensagem


GMCL1 polyclonal antibody

GMCL1 polyclonal antibody