FBXL16 polyclonal antibody
  • FBXL16 polyclonal antibody

FBXL16 polyclonal antibody

Ref: AB-PAB23555
FBXL16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBXL16.
Información adicional
Size 100 uL
Gene Name FBXL16
Gene Alias C16orf22|FLJ33735|Fbl16|MGC33974|c380A1.1
Gene Description F-box and leucine-rich repeat protein 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBXL16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146330
Iso type IgG

Enviar uma mensagem


FBXL16 polyclonal antibody

FBXL16 polyclonal antibody