AP3B2 polyclonal antibody
  • AP3B2 polyclonal antibody

AP3B2 polyclonal antibody

Ref: AB-PAB23545
AP3B2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AP3B2.
Información adicional
Size 100 uL
Gene Name AP3B2
Gene Alias DKFZp686D17136|NAPTB
Gene Description adaptor-related protein complex 3, beta 2 subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP3B2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8120
Iso type IgG

Enviar uma mensagem


AP3B2 polyclonal antibody

AP3B2 polyclonal antibody