CEP152 polyclonal antibody
  • CEP152 polyclonal antibody

CEP152 polyclonal antibody

Ref: AB-PAB23542
CEP152 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP152.
Información adicional
Size 100 uL
Gene Name CEP152
Gene Alias KIAA0912
Gene Description centrosomal protein 152kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP152.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22995
Iso type IgG

Enviar uma mensagem


CEP152 polyclonal antibody

CEP152 polyclonal antibody