ATHL1 polyclonal antibody
  • ATHL1 polyclonal antibody

ATHL1 polyclonal antibody

Ref: AB-PAB23538
ATHL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATHL1.
Información adicional
Size 100 uL
Gene Name ATHL1
Gene Alias FLJ22635|MGC129858|MGC129859
Gene Description ATH1, acid trehalase-like 1 (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FHQEFDGYEPGEVVKQADVVLLGYPVPFSLSPDVRRKNLEIYEAVTSPQGPAMTWSMFAVGWMELKDAVRARGLLDRSFANMAEPFKVWTENADGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATHL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80162
Iso type IgG

Enviar uma mensagem


ATHL1 polyclonal antibody

ATHL1 polyclonal antibody