NUDT22 polyclonal antibody
  • NUDT22 polyclonal antibody

NUDT22 polyclonal antibody

Ref: AB-PAB23533
NUDT22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUDT22.
Información adicional
Size 100 uL
Gene Name NUDT22
Gene Alias MGC13045
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUDT22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84304
Iso type IgG

Enviar uma mensagem


NUDT22 polyclonal antibody

NUDT22 polyclonal antibody