GALNT11 polyclonal antibody
  • GALNT11 polyclonal antibody

GALNT11 polyclonal antibody

Ref: AB-PAB23532
GALNT11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNT11.
Información adicional
Size 100 uL
Gene Name GALNT11
Gene Alias FLJ21634|MGC71630
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVLQRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNT11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63917
Iso type IgG

Enviar uma mensagem


GALNT11 polyclonal antibody

GALNT11 polyclonal antibody