TRAFD1 polyclonal antibody
  • TRAFD1 polyclonal antibody

TRAFD1 polyclonal antibody

Ref: AB-PAB23528
TRAFD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAFD1.
Información adicional
Size 100 uL
Gene Name TRAFD1
Gene Alias FLN29
Gene Description TRAF-type zinc finger domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSSPCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAFD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10906
Iso type IgG

Enviar uma mensagem


TRAFD1 polyclonal antibody

TRAFD1 polyclonal antibody