KLHL35 polyclonal antibody
  • KLHL35 polyclonal antibody

KLHL35 polyclonal antibody

Ref: AB-PAB23527
KLHL35 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHL35.
Información adicional
Size 100 uL
Gene Name KLHL35
Gene Alias 26597|FLJ33790
Gene Description kelch-like 35 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHL35.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283212
Iso type IgG

Enviar uma mensagem


KLHL35 polyclonal antibody

KLHL35 polyclonal antibody