TRIM7 polyclonal antibody
  • TRIM7 polyclonal antibody

TRIM7 polyclonal antibody

Ref: AB-PAB23526
TRIM7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIM7.
Información adicional
Size 100 uL
Gene Name TRIM7
Gene Alias GNIP|RNF90
Gene Description tripartite motif-containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIM7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81786
Iso type IgG

Enviar uma mensagem


TRIM7 polyclonal antibody

TRIM7 polyclonal antibody