PRRC1 polyclonal antibody
  • PRRC1 polyclonal antibody

PRRC1 polyclonal antibody

Ref: AB-PAB23525
PRRC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRRC1.
Información adicional
Size 100 uL
Gene Name PRRC1
Gene Alias FLJ32875
Gene Description proline-rich coiled-coil 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRRC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 133619
Iso type IgG

Enviar uma mensagem


PRRC1 polyclonal antibody

PRRC1 polyclonal antibody