C10orf125 polyclonal antibody
  • C10orf125 polyclonal antibody

C10orf125 polyclonal antibody

Ref: AB-PAB23524
C10orf125 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf125.
Información adicional
Size 100 uL
Gene Name C10orf125
Gene Alias FLJ26016|MGC149258
Gene Description chromosome 10 open reading frame 125
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf125.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 282969
Iso type IgG

Enviar uma mensagem


C10orf125 polyclonal antibody

C10orf125 polyclonal antibody