FAM149B1 polyclonal antibody
  • FAM149B1 polyclonal antibody

FAM149B1 polyclonal antibody

Ref: AB-PAB23520
FAM149B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM149B1.
Información adicional
Size 100 uL
Gene Name FAM149B1
Gene Alias KIAA0974
Gene Description family with sequence similarity 149, member B1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM149B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 317662
Iso type IgG

Enviar uma mensagem


FAM149B1 polyclonal antibody

FAM149B1 polyclonal antibody