MARK4 polyclonal antibody
  • MARK4 polyclonal antibody

MARK4 polyclonal antibody

Ref: AB-PAB23519
MARK4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MARK4.
Información adicional
Size 100 uL
Gene Name MARK4
Gene Alias FLJ90097|KIAA1860|MARKL1|Nbla00650
Gene Description MAP/microtubule affinity-regulating kinase 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MARK4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57787
Iso type IgG

Enviar uma mensagem


MARK4 polyclonal antibody

MARK4 polyclonal antibody