C5orf15 polyclonal antibody
  • C5orf15 polyclonal antibody

C5orf15 polyclonal antibody

Ref: AB-PAB23518
C5orf15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C5orf15.
Información adicional
Size 100 uL
Gene Name C5orf15
Gene Alias HTGN29|KCT2
Gene Description chromosome 5 open reading frame 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C5orf15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56951
Iso type IgG

Enviar uma mensagem


C5orf15 polyclonal antibody

C5orf15 polyclonal antibody