INTS10 polyclonal antibody
  • INTS10 polyclonal antibody

INTS10 polyclonal antibody

Ref: AB-PAB23514
INTS10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INTS10.
Información adicional
Size 100 uL
Gene Name INTS10
Gene Alias C8orf35|FLJ10569|INT10
Gene Description integrator complex subunit 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INTS10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55174
Iso type IgG

Enviar uma mensagem


INTS10 polyclonal antibody

INTS10 polyclonal antibody