CACNA1H polyclonal antibody
  • CACNA1H polyclonal antibody

CACNA1H polyclonal antibody

Ref: AB-PAB23513
CACNA1H polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CACNA1H.
Información adicional
Size 100 uL
Gene Name CACNA1H
Gene Alias CACNA1HB|Cav3.2|EIG6|FLJ90484
Gene Description calcium channel, voltage-dependent, T type, alpha 1H subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CACNA1H.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8912
Iso type IgG

Enviar uma mensagem


CACNA1H polyclonal antibody

CACNA1H polyclonal antibody