PANX2 polyclonal antibody
  • PANX2 polyclonal antibody

PANX2 polyclonal antibody

Ref: AB-PAB23512
PANX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PANX2.
Información adicional
Size 100 uL
Gene Name PANX2
Gene Alias MGC119432|PX2|hPANX2
Gene Description pannexin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PANX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56666
Iso type IgG

Enviar uma mensagem


PANX2 polyclonal antibody

PANX2 polyclonal antibody