CD99L2 polyclonal antibody
  • CD99L2 polyclonal antibody

CD99L2 polyclonal antibody

Ref: AB-PAB23507
CD99L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CD99L2.
Información adicional
Size 100 uL
Gene Name CD99L2
Gene Alias CD99B|DKFZp761H2024|MIC2L1
Gene Description CD99 molecule-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD99L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83692
Iso type IgG

Enviar uma mensagem


CD99L2 polyclonal antibody

CD99L2 polyclonal antibody