MADD polyclonal antibody
  • MADD polyclonal antibody

MADD polyclonal antibody

Ref: AB-PAB23504
MADD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MADD.
Información adicional
Size 100 uL
Gene Name MADD
Gene Alias DENN|FLJ35600|FLJ36300|IG20|KIAA0358|RAB3GEP
Gene Description MAP-kinase activating death domain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MADD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8567
Iso type IgG

Enviar uma mensagem


MADD polyclonal antibody

MADD polyclonal antibody