OLAH polyclonal antibody
  • OLAH polyclonal antibody

OLAH polyclonal antibody

Ref: AB-PAB23497
OLAH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OLAH.
Información adicional
Size 100 uL
Gene Name OLAH
Gene Alias AURA1|FLJ11106|MGC51852|SAST|THEDC1
Gene Description oleoyl-ACP hydrolase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLAH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55301
Iso type IgG

Enviar uma mensagem


OLAH polyclonal antibody

OLAH polyclonal antibody