NEK1 polyclonal antibody
  • NEK1 polyclonal antibody

NEK1 polyclonal antibody

Ref: AB-PAB23481
NEK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEK1.
Información adicional
Size 100 uL
Gene Name NEK1
Gene Alias DKFZp686D06121|DKFZp686K12169|KIAA1901|MGC138800|NY-REN-55
Gene Description NIMA (never in mitosis gene a)-related kinase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4750
Iso type IgG

Enviar uma mensagem


NEK1 polyclonal antibody

NEK1 polyclonal antibody