TXNDC14 polyclonal antibody
  • TXNDC14 polyclonal antibody

TXNDC14 polyclonal antibody

Ref: AB-PAB23480
TXNDC14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC14.
Información adicional
Size 100 uL
Gene Name TXNDC14
Gene Alias CGI-31|DKFZp781O2021|MGC111151|PIG26|TMX2
Gene Description thioredoxin domain containing 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51075
Iso type IgG

Enviar uma mensagem


TXNDC14 polyclonal antibody

TXNDC14 polyclonal antibody