SLC46A3 polyclonal antibody
  • SLC46A3 polyclonal antibody

SLC46A3 polyclonal antibody

Ref: AB-PAB23463
SLC46A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC46A3.
Información adicional
Size 100 uL
Gene Name SLC46A3
Gene Alias FKSG16|FLJ42613
Gene Description solute carrier family 46, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC46A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283537
Iso type IgG

Enviar uma mensagem


SLC46A3 polyclonal antibody

SLC46A3 polyclonal antibody