FLJ32810 polyclonal antibody
  • FLJ32810 polyclonal antibody

FLJ32810 polyclonal antibody

Ref: AB-PAB23462
FLJ32810 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ32810.
Información adicional
Size 100 uL
Gene Name FLJ32810
Gene Alias -
Gene Description hypothetical protein FLJ32810
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ32810.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 143872
Iso type IgG

Enviar uma mensagem


FLJ32810 polyclonal antibody

FLJ32810 polyclonal antibody