ANKRD42 polyclonal antibody
  • ANKRD42 polyclonal antibody

ANKRD42 polyclonal antibody

Ref: AB-PAB23460
ANKRD42 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD42.
Información adicional
Size 100 uL
Gene Name ANKRD42
Gene Alias FLJ37874|SARP
Gene Description ankyrin repeat domain 42
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD42.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338699
Iso type IgG

Enviar uma mensagem


ANKRD42 polyclonal antibody

ANKRD42 polyclonal antibody